Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004929-M07 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004929-M07, RRID:AB_581593
- Product name
- NR4A2 monoclonal antibody (M07), clone 4A6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NR4A2.
- Antigen sequence
GFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKT
PVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMN
PEPAGSHHVVDGQTFAVPNPIRKPASMGFP- Isotype
- IgG
- Antibody clone number
- 4A6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Neural differentiation potential of human bone marrow-derived mesenchymal stromal cells: misleading marker gene expression.
Montzka K, Lassonczyk N, Tschöke B, Neuss S, Führmann T, Franzen R, Smeets R, Brook GA, Wöltje M
BMC neuroscience 2009 Mar 3;10:16
BMC neuroscience 2009 Mar 3;10:16
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NR4A2 expression in transfected 293T cell line by NR4A2 monoclonal antibody (M07), clone 4A6.Lane 1: NR4A2 transfected lysate (Predicted MW: 66.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NR4A2 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to NR4A2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol