H00004929-M21

NR4A2 antibody from Abnova Corporation
HZF-3, NOT, NURR1, RNR1, TINUR
No application information provided.

Antibody data

Product number
H00004929-M21
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004929-M21, RRID:AB_1204741
Product name
NR4A2 monoclonal antibody (M21), clone 2C12
Provider product page
Abnova Corporation - H00004929-M21
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NR4A2.
Antigen sequence
GSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQS
PPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQ
TFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPS*
Isotype
IgG
Antibody clone number
2C12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -