Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309910 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear Receptor Subfamily 4, Group A, Member 2 (NR4A2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NR4A2 antibody: synthetic peptide directed towards the N terminal of human NR4A2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFL
TPEFV KFSMDLTNTE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Melanocortin-1 receptor signaling markedly induces the expression of the NR4A nuclear receptor subgroup in melanocytic cells.
Smith AG, Luk N, Newton RA, Roberts DW, Sturm RA, Muscat GE
The Journal of biological chemistry 2008 May 2;283(18):12564-70
The Journal of biological chemistry 2008 May 2;283(18):12564-70
No comments: Submit comment
No validations: Submit validation data