Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000543 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000543, RRID:AB_1854631
- Product name
- Anti-NR4A2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPE
FVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDV
KPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPP
QSEEMMPHSGSVYYKP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Wilms tumor chromatin profiles highlight stem cell properties and a renal developmental network.
From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies.
Aiden AP, Rivera MN, Rheinbay E, Ku M, Coffman EJ, Truong TT, Vargas SO, Lander ES, Haber DA, Bernstein BE
Cell stem cell 2010 Jun 4;6(6):591-602
Cell stem cell 2010 Jun 4;6(6):591-602
From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies.
Ek S, Andréasson U, Hober S, Kampf C, Pontén F, Uhlén M, Merz H, Borrebaeck CA
Molecular & cellular proteomics : MCP 2006 Jun;5(6):1072-81
Molecular & cellular proteomics : MCP 2006 Jun;5(6):1072-81
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line SiHa shows localization to nuclear speckles.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate membranous and nuclear positivity in cells in tubules.
- Sample type
- HUMAN