HPA000543

NR4A2 antibody from Atlas Antibodies
HZF-3, NOT, NURR1, RNR1, TINUR
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000543
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000543, RRID:AB_1854631
Product name
Anti-NR4A2
Provider product page
Atlas Antibodies - HPA000543
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPE
FVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDV
KPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPP
QSEEMMPHSGSVYYKP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -