HPA000543

NR4A2 antibody from Sigma-Aldrich
HZF-3, NOT, NURR1, RNR1, TINUR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000543
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000543, RRID:AB_1854631
Product name
Anti-NR4A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000543
Antibody type
Polyclonal
Antigen
Nuclear receptor subfamily 4 group A member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPE
FVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDV
KPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPP
QSEEMMPHSGSVYYKP
Storage
-20C
Provider Type Product Number
- No reagents -