HPA018113

TTBK2 antibody from Sigma-Aldrich
KIAA0847, SCA11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018113
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018113, RRID:AB_1858421
Product name
Anti-TTBK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018113
Antibody type
Polyclonal
Antigen
Tau-tubulin kinase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TTEPLDVTKTQTFSVVPNQDKNNEIMKLLTVGTSE
ISSRDIDPHVEGQIGQVAEMQKNKISKDDDIMSED
LPGHQGDLSTFLHQEGKREKITPRNGELFHCVS
Storage
-20C
Provider Type Product Number
- No reagents -