Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA018113 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA018113, RRID:AB_1858421
- Product name
- Anti-TTBK2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TTEPLDVTKTQTFSVVPNQDKNNEIMKLLTVGTSE
ISSRDIDPHVEGQIGQVAEMQKNKISKDDDIMSED
LPGHQGDLSTFLHQEGKREKITPRNGELFHCVS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Lineage specificity of primary cilia in the mouse embryo.
Cep164 triggers ciliogenesis by recruiting Tau tubulin kinase 2 to the mother centriole.
Bangs FK, Schrode N, Hadjantonakis AK, Anderson KV
Nature cell biology 2015 Feb;17(2):113-22
Nature cell biology 2015 Feb;17(2):113-22
Cep164 triggers ciliogenesis by recruiting Tau tubulin kinase 2 to the mother centriole.
Čajánek L, Nigg EA
Proceedings of the National Academy of Sciences of the United States of America 2014 Jul 15;111(28):E2841-50
Proceedings of the National Academy of Sciences of the United States of America 2014 Jul 15;111(28):E2841-50
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and TTBK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406582).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in spermatids and sperm.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows very weak positivity in myocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human Fallopian tube shows strong positivity in cilia in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
- Sample type
- HUMAN