HPA018157

PAFAH2 antibody from Sigma-Aldrich
HSD-PLA2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018157
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018157, RRID:AB_1854928
Product name
Anti-PAFAH2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018157
Antibody type
Polyclonal
Antigen
Platelet-activating factor acetylhydrolase 2, cytoplasmic recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RGFVVAVPEHRDRSAATTYFCKQAPEENQPTNESL
QEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVL
KILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVA
VMGHS
Storage
-20C
Provider Type Product Number
- No reagents -