Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310595 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger, DHHC-Type Containing 13 (ZDHHC13) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZDHHC13 antibody: synthetic peptide directed towards the N terminal of human ZDHHC13
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPII
AYLIS KGQSVNMTDV- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
Matsuda A, Suzuki Y, Honda G, Muramatsu S, Matsuzaki O, Nagano Y, Doi T, Shimotohno K, Harada T, Nishida E, Hayashi H, Sugano S
Oncogene 2003 May 22;22(21):3307-18
Oncogene 2003 May 22;22(21):3307-18
No comments: Submit comment
No validations: Submit validation data