HPA016759

ZDHHC13 antibody from Sigma-Aldrich
FLJ10852, FLJ10941, HIP14L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016759
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016759, RRID:AB_1858993
Product name
Anti-ZDHHC13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016759
Antibody type
Polyclonal
Antigen
Probable palmitoyltransferase ZDHHC13 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IAYLISKGQSVNMTDVNGQTPLMLSAHKVIGPEPT
GFLLKFNPSLNVVDKIHQNTPLHWAVAAGNVNAVD
KLLEAGSSLDIQNVKGETPLDMALQN
Storage
-20C
Provider Type Product Number
- No reagents -