HPA000390

AUTS2 antibody from Atlas Antibodies
FBRSL2, KIAA0442
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000390
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000390, RRID:AB_1233527
Product name
Anti-AUTS2
Provider product page
Atlas Antibodies - HPA000390
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDRT
RMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDP
YRELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEAD
R
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -