HPA000390

AUTS2 antibody from Sigma-Aldrich
FBRSL2, KIAA0442
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000390
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000390, RRID:AB_1845218
Product name
Anti-AUTS2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000390
Antibody type
Polyclonal
Antigen
Autism susceptibility gene 2 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDRT
RMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDP
YRELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEAD
R
Storage
-20C
Provider Type Product Number
- No reagents -