Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001457-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001457-M01, RRID:AB_804915
- Product name
- CSNK2A1 monoclonal antibody (M01), clone 3D9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CSNK2A1.
- Antigen sequence
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGN
QDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKIL
KPVKKKKIKREIKILENLRGGPNIITLADI- Isotype
- IgG
- Antibody clone number
- 3D9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references CK2 inhibitors enhance the radiosensitivity of human non-small cell lung cancer cells through inhibition of stat3 activation.
Lin YC, Hung MS, Lin CK, Li JM, Lee KD, Li YC, Chen MF, Chen JK, Yang CT
Cancer biotherapy & radiopharmaceuticals 2011 Jun;26(3):381-8
Cancer biotherapy & radiopharmaceuticals 2011 Jun;26(3):381-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CSNK2A1 monoclonal antibody (M01), clone 3D9 Western Blot analysis of CSNK2A1 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CSNK2A1 expression in transfected 293T cell line by CSNK2A1 monoclonal antibody (M01), clone 3D9.Lane 1: CSNK2A1 transfected lysate(45.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CSNK2A1 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CSNK2A1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between TP53 and CSNK2A1. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-CSNK2A1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)