Antibody data

Product number
ABIN1545313
Provider
antibodies-online
Product name
anti-Ankyrin Repeat Domain 55 (ANKRD55) (C-Term) antibody
Provider product page
antibodies-online - ABIN1545313
Antibody type
Polyclonal
Antigen
The immunogen for Anti-ANKRD55 antibody is: synthetic peptide directed towards the C-terminal region of Human ANKRD55
Reactivity
Human
Host
Rabbit
Antigen sequence
LSQESRTEPTRPPPSQSSRPQKKERRFNVLNQIFC
KNKKE EQRAHQKDPS
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.