H00114548-B01P

NLRP3 antibody from Abnova Corporation
AGTAVPRL, AII, AVP, C1orf7, CIAS1, CLR1.1, DFNA34, FCAS, FCU, MWS, NALP3, PYPAF1

Antibody data

Product number
H00114548-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00114548-B01P, RRID:AB_1573056
Product name
NLRP3 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00114548-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human NLRP3 protein.
Antigen sequence
MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQ
KGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAM
AVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPT
VICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKY
RKYVRSRFQCIEDRNARLGESVSLNKRYTRLRLIK
EHRSQQEREQELLAIGKTKTCESPVSPIKMELLFD
PDDEHSEPVHTVVFQGAAGIGKTILARKMMLDWAS
GTLYQDRFDYLFYIHCREVSLVTQRSLGDLIMSCC
PDPNPPIHKIVRKPSRILFLMDGFDELQGAFDEHI
GPLCTDWQKAERGDILLSSLIRKKLLPEASLLITT
RPVALEKLQHLLDHPRHVEILGFSEAKRKEYFFKY
FSDEAQARAAFSLIQENEVLFTMCFIPLVCWIVCT
GLKQQMESGKSLAQTSKTTTAVYVFFLSSLLQPRG
GSQEHGLCAHLWGLCSLAADGIWNQKILFEESDLR
NHGLQKADVSAFLRMNLFQKEVDCEKFYSFIHMTF
QEFFAAMYYLLEEEKEGRTNVPGSRLKLPSRDVTV
LLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKK
LSCKISQQIRLELLKWIEVKAKAKKLQIQPSQLEL
FYCLYEMQEEDFVQRAMDYFPKIEINLSTRMDHMV
SSFCIENCHRVESLSLGFLHNMPKEEEEEEKEGRH
LDMVQCVLPSSSHAACSHGLVNSHLTSSFCRGLFS
VLSTSQSLTELDLSDNSLGDPGMRVLCETLQHPGC
NIRRLWLGRCGLSHECCFDISLVLSSNQKLVELDL
SDNALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLT
SACCQDLASVLSTSHSLTRLYVGENALGDSGVAIL
CEKAKNPQCNLQKLGLVNSGLTSVCCSALSSVLST
NQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQV
LELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNND
LGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETK
SALETLQEEKPELTVVFEPSW
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -