HPA012878

NLRP3 antibody from Sigma-Aldrich
AGTAVPRL, AII, AVP, C1orf7, CIAS1, CLR1.1, FCAS, FCU, MWS, NALP3, PYPAF1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012878
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012878, RRID:AB_1846752
Product name
Anti-NLRP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012878
Antibody type
Polyclonal
Antigen
NACHT, LRR and PYD domains-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMI
DFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKW
GSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISI
CKMKKDYRKKYR
Storage
-20C
Provider Type Product Number
- No reagents -