HPA025704

SPDYE4 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025704
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025704, RRID:AB_1853093
Product name
Anti-SPDYE4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025704
Antibody type
Polyclonal
Antigen
Putative WBSCR19-like protein 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KCLGEIMASGQARPPFEEESPQPSTTVRSPEVVVD
DEVPGPSAPWIDPSPQPQSLGLKRKSEWSD
Storage
-20C
Provider Type Product Number
- No reagents -