Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90502 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90502, RRID:AB_2665568
- Product name
- Anti-SOX11
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKML
KDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPK
MDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTS
KGSSKK- Epitope
- Binds to an epitope located within the peptide sequence IPFIREAERL as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0143
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Plasma cell and terminal B-cell differentiation in mantle cell lymphoma mainly occur in the SOX11-negative subtype
Assessment of SOX11 expression in routine lymphoma tissue sections: characterization of new monoclonal antibodies for diagnosis of mantle cell lymphoma.
Assessment of SOX11 Expression in Routine Lymphoma Tissue Sections
Ribera-Cortada I, Martinez D, Amador V, Royo C, Navarro A, Beà S, Gine E, de Leval L, Serrano S, Wotherspoon A, Colomer D, Martinez A, Campo E
Modern Pathology 2015 September;28(11):1435-1447
Modern Pathology 2015 September;28(11):1435-1447
Assessment of SOX11 expression in routine lymphoma tissue sections: characterization of new monoclonal antibodies for diagnosis of mantle cell lymphoma.
Soldini D, Valera A, Solé C, Palomero J, Amador V, Martin-Subero JI, Ribera-Cortada I, Royo C, Salaverria I, Beà S, Gonzalvo E, Johannesson H, Herrera M, Colomo L, Martinez A, Campo E
The American journal of surgical pathology 2014 Jan;38(1):86-93
The American journal of surgical pathology 2014 Jan;38(1):86-93
Assessment of SOX11 Expression in Routine Lymphoma Tissue Sections
Soldini D, Valera A, Solé C, Palomero J, Amador V, Martin-Subero J, Ribera-Cortada I, Royo C, Salaverria I, Beà S, Gonzalvo E, Johannesson H, Herrera M, Colomo L, Martinez A, Campo E
The American Journal of Surgical Pathology 2014 ;38(1):86-93
The American Journal of Surgical Pathology 2014 ;38(1):86-93
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: SOX11 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418895)
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human mantle cell lymphoma shows strong nuclear positivity in a majority of tumor cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human chronic lymphoid leukemia shows no positivity in tumor cells (negative control).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human mantle cell lymphoma shows moderate to strong nuclear positivity in tumor cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human chronic lymphocytic leukemia shows no nuclear positivity in tumor cells as expected.