Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182780 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SRY (Sex Determining Region Y)-Box 11 (SOX11) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SOX11 antibody: synthetic peptide directed towards the N terminal of human SOX11
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
MVQQAESLEAESNLPREALDTEEGEFMACSPVALD
ESDPD WCKTASGHIK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Sox11 modulates neocortical development by regulating the proliferation and neuronal differentiation of cortical intermediate precursors.
Alcohol consumption, alcohol outlets, and the risk of being assaulted with a gun.
Identification of novel domains within Sox-2 and Sox-11 involved in autoinhibition of DNA binding and partnership specificity.
Li Y, Wang J, Zheng Y, Zhao Y, Guo M, Li Y, Bao Q, Zhang Y, Yang L, Li Q
Acta biochimica et biophysica Sinica 2012 Aug;44(8):660-8
Acta biochimica et biophysica Sinica 2012 Aug;44(8):660-8
Alcohol consumption, alcohol outlets, and the risk of being assaulted with a gun.
Branas CC, Elliott MR, Richmond TS, Culhane DP, Wiebe DJ
Alcoholism, clinical and experimental research 2009 May;33(5):906-15
Alcoholism, clinical and experimental research 2009 May;33(5):906-15
Identification of novel domains within Sox-2 and Sox-11 involved in autoinhibition of DNA binding and partnership specificity.
Wiebe MS, Nowling TK, Rizzino A
The Journal of biological chemistry 2003 May 16;278(20):17901-11
The Journal of biological chemistry 2003 May 16;278(20):17901-11
No comments: Submit comment
No validations: Submit validation data