HPA000923

THSD7A antibody from Sigma-Aldrich
KIAA0960
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000923
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000923, RRID:AB_1080271
Product name
Anti-THSD7A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000923
Antibody type
Polyclonal
Antigen
Thrombospondin type-1 domain-containing protein 7A precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VCQSSPCEAEELRYSLHVGPWSTCSMPHSRQVRQA
RRRGKNKEREKDRSKGVKDPEARELIKKKRNRNRQ
NRQENKYWDIQIGYQTREVMCINKTGKAADLSFCQ
QEKLPMTFQSC
Storage
-20C
Provider Type Product Number
- No reagents -