HPA052490

FAM24B antibody from Atlas Antibodies
AC073585.2, MGC45962
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA052490
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA052490, RRID:AB_2681851
Product name
Anti-FAM24B
Provider product page
Atlas Antibodies - HPA052490
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TESCPALQCCEGYRMCASFDSLPPCCCDINEGL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -