HPA052819

FAT4 antibody from Atlas Antibodies
CDHF14, CDHR11, FAT-J
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA052819
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA052819, RRID:AB_2681963
Product name
Anti-FAT4
Provider product page
Atlas Antibodies - HPA052819
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FDDPDNIPPYGDDMTVRKQPEGNPKPDIIERENPY
LIYDETDIPHNSETIPSAPLASPEQEIEHYDIDNA
SSIAPSDADIIQHYKQFRSHT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -