HPA000544

MAST4 antibody from Atlas Antibodies
KIAA0303
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000544
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000544, RRID:AB_1079315
Product name
Anti-MAST4
Provider product page
Atlas Antibodies - HPA000544
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PEKQESHQKSHGPGSDLENFALFKLEEREKKVYPK
AVERSSTFENKASMQEAPPLGSLLKDALHKQASVR
ASEGAMSDGPVPAEHRQGGGDFRRAPAPGTLQDGL
CHS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -