HPA000544

MAST4 antibody from Sigma-Aldrich
KIAA0303
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000544
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000544, RRID:AB_1079315
Product name
Anti-MAST4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000544
Antibody type
Polyclonal
Antigen
Microtubule-associated serine/threonine-protein kinase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEKQESHQKSHGPGSDLENFALFKLEEREKKVYPK
AVERSSTFENKASMQEAPPLGSLLKDALHKQASVR
ASEGAMSDGPVPAEHRQGGGDFRRAPAPGTLQDGL
CHS
Storage
-20C
Provider Type Product Number
- No reagents -