HPA027762

USP43 antibody from Sigma-Aldrich
FLJ30626
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027762
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027762, RRID:AB_10603001
Product name
Anti-USP43 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027762
Antibody type
Polyclonal
Antigen
ubiquitin specific peptidase 43 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SMRGSTSSSLSDHWLLRLGSHAGSTRGSLLSWSSA
PCPSLPQVPDSPIFTNSLCNQEKGGLEPRRLVRGV
KGRSISMKAPTTSRAKQGPFKTMPLRWSFGSKEKP
PGASVELVEYLESRRRPRSTSQSIVSLLT
Storage
-20C
Provider Type Product Number
- No reagents -