HPA000686

NINL antibody from Atlas Antibodies
KIAA0980, NLP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000686
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000686, RRID:AB_1079193
Product name
Anti-NINL
Provider product page
Atlas Antibodies - HPA000686
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LHEKSQEVIWGLQEQLQDTARGPEPEQMGLAPCCT
QALCGLALRHHSHLQQIRREAEAELSGELSGLGAL
PARRDLTLELEEPPQGPLPRGSQRSEQLELERALK
L
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -