HPA000686

NINL antibody from Sigma-Aldrich
KIAA0980, NLP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000686
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000686, RRID:AB_1079193
Product name
Anti-NLP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000686
Antibody type
Polyclonal
Antigen
Ninein-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LHEKSQEVIWGLQEQLQDTARGPEPEQMGLAPCCT
QALCGLALRHHSHLQQIRREAEAELSGELSGLGAL
PARRDLTLELEEPPQGPLPRGSQRSEQLELERALK
L
Storage
-20C
Provider Type Product Number
- No reagents -