Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023049-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023049-M02, RRID:AB_875840
- Product name
- SMG1 monoclonal antibody (M02), clone 1A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SMG1.
- Antigen sequence
PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVA
CSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLE
GRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEG
WTAWV- Isotype
- IgG
- Antibody clone number
- 1A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The nonsense-mediated mRNA decay SMG-1 kinase is regulated by large-scale conformational changes controlled by SMG-8.
Processing bodies are not required for mammalian nonsense-mediated mRNA decay.
Arias-Palomo E, Yamashita A, Fernández IS, Núñez-Ramírez R, Bamba Y, Izumi N, Ohno S, Llorca O
Genes & development 2011 Jan 15;25(2):153-64
Genes & development 2011 Jan 15;25(2):153-64
Processing bodies are not required for mammalian nonsense-mediated mRNA decay.
Stalder L, Mühlemann O
RNA (New York, N.Y.) 2009 Jul;15(7):1265-73
RNA (New York, N.Y.) 2009 Jul;15(7):1265-73
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SMG1 monoclonal antibody (M02), clone 1A8 Western Blot analysis of SMG1 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SMG1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SMG1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol