HPA000538

PHF14 antibody from Sigma-Aldrich
KIAA0783
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000538
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000538, RRID:AB_1079604
Product name
Anti-PHF14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000538
Antibody type
Polyclonal
Antigen
PHD finger protein 14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AQKEGLLSEAAAEEDIADPFFAYCKQHADRLDRKW
KRKNYLALQSYCKMSLQEREKQLSPEAQARINARL
QQYRAKAELARSTRPQAWVPREKLPRPLTSSASAI
RKLMRKAELMGISTDIF
Storage
-20C
Provider Type Product Number
- No reagents -