Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB15836 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB15836, RRID:AB_10688550
- Product name
- Myt1l polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial recombinant Myt1l.
- Antigen sequence
RATSAMKKAKLSGEQMLTIKQRASNGIENDEEIKQ
LDEEIKELNESNSQMEADMIKLRTQITTMESNLKT
IEEENKVIEQQNESLLHELANLSQSLIHSLANIQL
PHMDPINEQNFDAYVTTLTEMYTNQDRYQSPENKA
LLENIKQAVRGIQV- Storage
- Store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references Generation of patient-specific induced neuronal cells using a direct reprogramming strategy.
From the Cover: Neutralization of terminal differentiation in gliomagenesis.
Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.
Wang P, Zhang HL, Li W, Sha H, Xu C, Yao L, Tang Q, Tang H, Chen L, Zhu J
Stem cells and development 2014 Jan 1;23(1):16-23
Stem cells and development 2014 Jan 1;23(1):16-23
From the Cover: Neutralization of terminal differentiation in gliomagenesis.
Hu J, Ho AL, Yuan L, Hu B, Hua S, Hwang SS, Zhang J, Hu T, Zheng H, Gan B, Wu G, Wang YA, Chin L, DePinho RA
Proceedings of the National Academy of Sciences of the United States of America 2013 Sep 3;110(36):14520-7
Proceedings of the National Academy of Sciences of the United States of America 2013 Sep 3;110(36):14520-7
Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.
Okazaki N, Kikuno R, Ohara R, Inamoto S, Aizawa H, Yuasa S, Nakajima D, Nagase T, Ohara O, Koga H
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Feb 28;10(1):35-48
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Feb 28;10(1):35-48
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis bacterial lysate of MBP-fused antigen protein by using Myt1l polyclonal antibody (Cat. PAB15836).