Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB22303 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB22303, RRID:AB_10967556
- Product name
- DHRS7C polyclonal antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein corresponding to amino acids of human DHRS7C.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
- FRKLTYGVHPVEVAEEVMRTVRRKKQEVFMANPIP
 KAAVYVRTFFPEFFFAVVACGVKEKLNVPEE
- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunohistochemical staining of human placenta with DHRS7C polyclonal antibody (Cat # PAB22303) shows moderate positivity in trophoblastic cells at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)