HPA000657

ACIN1 antibody from Sigma-Aldrich
ACINUS, fSAP152, KIAA0670
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000657
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000657, RRID:AB_1078091
Product name
Anti-ACIN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000657
Antibody type
Polyclonal
Antigen
Apoptotic chromatin condensation inducer in the nucleus recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQK
EAERAERAKEREKRRKEQEEEEQKEREKEAERERN
RQLEREKRREHSRERDRERERERERDRGDRDRDRE
RDRERGRERDRRDTKRHSRSRSRSTPV
Storage
-20C
Provider Type Product Number
- No reagents -