Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310998 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Enolase 3 (Beta, Muscle) (ENO3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ENO3 antibody: synthetic peptide directed towards the N terminal of human ENO3
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Rabbit
- Host
- Rabbit
- Antigen sequence
MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAV
PSGAS TGIYEALELR- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Differential expression of metabolic genes in tumor and stromal components of primary and metastatic loci in pancreatic adenocarcinoma.
Characterization of MR-1, a novel myofibrillogenesis regulator in human muscle.
Chaika NV, Yu F, Purohit V, Mehla K, Lazenby AJ, DiMaio D, Anderson JM, Yeh JJ, Johnson KR, Hollingsworth MA, Singh PK
PloS one 2012;7(3):e32996
PloS one 2012;7(3):e32996
Characterization of MR-1, a novel myofibrillogenesis regulator in human muscle.
Li TB, Liu XH, Feng S, Hu Y, Yang WX, Han Y, Wang YG, Gong LM
Acta biochimica et biophysica Sinica 2004 Jun;36(6):412-8
Acta biochimica et biophysica Sinica 2004 Jun;36(6):412-8
No comments: Submit comment
No validations: Submit validation data