Antibody data

Product number
H00002027-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002027-M04, RRID:AB_1136928
Product name
ENO3 monoclonal antibody (M04), clone 3C6
Provider product page
Abnova Corporation - H00002027-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ENO3.
Antigen sequence
MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAV
PSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN
STLGPALLQKKLSVADQEKVDKFMIELDGTENKSK
FGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGN
PDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGA
SSFKEAMRIGAEVYHHLKGVIKAKYGKDATNVGDE
GGFAPNILENNEALELLKTAIQAAGYPDKVVIGMD
VAASEFYRNGKYDLDFKSPDDPARHITGEKLGELY
KSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQI
VGDDLTVTNPKRIAQAVEKKACNCLLLKVNQIGSV
TESIQACKLAQSNGWGVMVSHRSGETEDTFIADLV
VGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDK
AIFAGRKFRNPKAK
Isotype
IgG
Antibody clone number
3C6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -