Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002027-M01A - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002027-M01A, RRID:AB_10617087
- Product name
- ENO3 monoclonal antibody (M01A), clone 5D1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ENO3.
- Antigen sequence
KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFK
SPDDPARHITGEKLG- Isotype
- IgG
- Antibody clone number
- 5D1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ENO3 monoclonal antibody (M01A), clone 5D1 Western Blot analysis of ENO3 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ENO3 expression in transfected 293T cell line by ENO3 monoclonal antibody (M01A), clone 5D1.Lane 1: ENO3 transfected lysate(46.9 KDa).Lane 2: Non-transfected lysate.