HPA000793

ENO3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000793
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000793, RRID:AB_1078742
Product name
Anti-ENO3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000793
Antibody type
Polyclonal
Antigen
beta-Enolase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKY
DLDFKSPDDPARHITGEKLGELYKSFIKNYPVVSI
EDPFDQDDWATWTSFLSGVNIQIVGDDLTVTN
Storage
-20C
Provider Type Product Number
- No reagents -