HPA024264

SCIN antibody from Sigma-Aldrich
KIAA1905
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024264
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024264, RRID:AB_1856621
Product name
Anti-SCIN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024264
Antibody type
Polyclonal
Antigen
Adseverin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RNLASITRIVEVDVDANSLNSNDVFVLKLPQNSGY
IWVGKGASQEEEKGAEYVASVLKCKTLRIQEGEEP
EEFWNSLGGKKDYQTSPLLETQAEDHPPRLYGCSN
K
Storage
-20C
Provider Type Product Number
- No reagents -