HPA000572

CLU antibody from Atlas Antibodies
APOJ, CLI, CLU1, CLU2, KUB1, SGP-2, SP-40, TRPM-2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000572
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000572, RRID:AB_1078539
Product name
Anti-CLU
Provider product page
Atlas Antibodies - HPA000572
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHF
FFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHE
AQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREI
RHNS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -