HPA000572

CLU antibody from Sigma-Aldrich
APOJ, CLI, CLU1, CLU2, KUB1, SGP-2, SP-40, TRPM-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000572
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000572, RRID:AB_1078539
Product name
Anti-CLU antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000572
Antibody type
Polyclonal
Antigen
Clusterin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHF
FFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHE
AQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREI
RHNS
Storage
-20C
Provider Type Product Number
- No reagents -