Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008570-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008570-A01, RRID:AB_463217
- Product name
- KHSRP polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant KHSRP.
- Antigen sequence
VPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSG
GLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPP
GQFHDNANGGQNGTVQEIM- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification of FUSE-binding protein 1 as a regulatory mRNA-binding protein that represses nucleophosmin translation.
A cytoplasmic variant of the KH-type splicing regulatory protein serves as a decay-promoting factor for phosphoglycerate kinase 2 mRNA in murine male germ cells.
Olanich ME, Moss BL, Piwnica-Worms D, Townsend RR, Weber JD
Oncogene 2011 Jan 6;30(1):77-86
Oncogene 2011 Jan 6;30(1):77-86
A cytoplasmic variant of the KH-type splicing regulatory protein serves as a decay-promoting factor for phosphoglycerate kinase 2 mRNA in murine male germ cells.
Xu M, McCarrey JR, Hecht NB
Nucleic acids research 2008 Dec;36(22):7157-67
Nucleic acids research 2008 Dec;36(22):7157-67
No comments: Submit comment
No validations: Submit validation data