HPA000545

NREP antibody from Atlas Antibodies
C5orf13, D4S114, P311, PRO1873, PTZ17, SEZ17

Antibody data

Product number
HPA000545
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000545, RRID:AB_1845721
Product name
Anti-NREP
Provider product page
Atlas Antibodies - HPA000545
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVN
RKKNDETNAASLTPLGSSEL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.