HPA000545

NREP antibody from Atlas Antibodies
C5orf13, D4S114, P311, PRO1873, PTZ17, SEZ17
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000545
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000545, RRID:AB_1233632
Product name
Anti-NREP
Provider product page
Atlas Antibodies - HPA000545
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVN
RKKNDETNAASLTPLGSSEL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -