HPA000545

NREP antibody from Sigma-Aldrich
C5orf13, D4S114, P311, PRO1873, PTZ17, SEZ17
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000545
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000545, RRID:AB_1845721
Product name
Anti-C5orf13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000545
Antibody type
Polyclonal
Antigen
Neuronal protein 31 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVN
RKKNDETNAASLTPLGSSEL
Storage
-20C
Provider Type Product Number
- No reagents -