Antibody data

Product number
H00005962-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005962-M01A, RRID:AB_1579669
Product name
RDX monoclonal antibody (M01A), clone 1E12
Provider product page
Abnova Corporation - H00005962-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant RDX.
Antigen sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVK
TVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDV
KKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQ
VKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKE
IHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNW
HEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKN
KKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEI
RNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI
LALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQ
KQLERAQLENEKEKREIAEKEKERIEREKEELMER
LKQIEEQTIKAQKELEEQTRKALELDQERKRAKEE
AERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAE
LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQED
LEKTKEELKTVMSAPPPPPPPPVIPPTENEHDEHD
ENNAEASAELSNEGVMNHRSEEERVTETQKNERVK
KQLQALSSELAQARDETKKTQNDVLHAENVKAGRD
KYKTLRQIRQGNTKQRIDEFEAM
Isotype
IgG
Antibody clone number
1E12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -