HPA000263

RDX antibody from Sigma-Aldrich
DFNB24
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000263
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000263, RRID:AB_1856043
Product name
Anti-RDX antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000263
Antibody type
Polyclonal
Antigen
Radixin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFP
EDVSEELIQEITQRLFFLQVKEAILNDEIYCPPET
AVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQR
VLEQHKLTKEQWEERIQ
Storage
-20C
Provider Type Product Number
- No reagents -