H00003627-M05

CXCL10 antibody from Abnova Corporation
C7, crg-2, gIP-10, IFI10, INP10, IP-10, mob-1, SCYB10

Antibody data

Product number
H00003627-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003627-M05, RRID:AB_1204243
Product name
CXCL10 monoclonal antibody (M05), clone 1E9
Provider product page
Abnova Corporation - H00003627-M05
Antibody type
Monoclonal
Antigen
CXCL10 (AAH10954, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Reactivity
Human
Host
Mouse
Antigen sequence
MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISI
SNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKG
EKRCLNPESKAIKNLLKAVSKERSKRSP
Isotype
IgG
Vial size
100 µg
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -