Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011075-M07 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011075-M07, RRID:AB_875861
- Product name
- STMN2 monoclonal antibody (M07), clone 2G7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant STMN2.
- Antigen sequence
SPKKKDLSLEEIQKKLEAAEERRKSQEAQVLKQLA
EKREHEREVLQKALEENNNFSKMAEEKLILKMEQI
KENREANLAAIIERLQEKERHAAEVRRNKELQVEL
SG*- Isotype
- IgG
- Antibody clone number
- 2G7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- STMN2 monoclonal antibody (M07), clone 2G7 Western Blot analysis of STMN2 expression in IMR-32 ( Cat # L008V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of STMN2 expression in transfected 293T cell line by STMN2 monoclonal antibody (M07), clone 2G7.Lane 1: STMN2 transfected lysate(20.8 KDa).Lane 2: Non-transfected lysate.