Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504653 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ets Variant 6 (ETV6) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ETV6 antibody: synthetic peptide directed towards the N terminal of human ETV6
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
WAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRS
PHSGD VLYELLQHIL- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Prospective analysis of TEL gene rearrangements in childhood acute lymphoblastic leukemia: a Children's Oncology Group study.
Rubnitz JE, Wichlan D, Devidas M, Shuster J, Linda SB, Kurtzberg J, Bell B, Hunger SP, Chauvenet A, Pui CH, Camitta B, Pullen J, Children's Oncology Group
Journal of clinical oncology : official journal of the American Society of Clinical Oncology 2008 May 1;26(13):2186-91
Journal of clinical oncology : official journal of the American Society of Clinical Oncology 2008 May 1;26(13):2186-91
No comments: Submit comment
No validations: Submit validation data