HPA000264

ETV6 antibody from Atlas Antibodies
TEL
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000264
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000264, RRID:AB_611466
Product name
Anti-ETV6
Provider product page
Atlas Antibodies - HPA000264
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQR
KPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQ
RTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSP
DPEQRPLRSPLDNMIR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -