HPA000264

ETV6 antibody from Sigma-Aldrich
TEL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000264
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000264, RRID:AB_1078763
Product name
Anti-ETV6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000264
Antibody type
Polyclonal
Antigen
Transcription factor ETV6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQR
KPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQ
RTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSP
DPEQRPLRSPLDNMIR
Storage
-20C
Provider Type Product Number
- No reagents -