HPA026637

CCDC158 antibody from MilliporeSigma / Merck KGaA
FLJ25770
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026637
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA026637, RRID:AB_1848844
Product name
Anti-AC034139.7-2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026637
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein FLJ25770 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IIPSPGKEHFERVLEEYSHQVKDLQRRLNESNELH
EKQKFYLRQSVIDLQTKLQEMQMERDAMADIRRRE
SQSQEDLRNQLQNTVHELEAAKCLKEDMLKDSNTQ
IEQLRKMMLSHEGVLQEIRSILVDFEE
Storage
-20C
Provider Type Product Number
- No reagents -